Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG129400.3.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 729aa    MW: 78515.3 Da    PI: 6.3945
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG129400.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++lgL+ rqVk+WFqNrR+++k
                          678899***********************************************999 PP

                START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla. 77 
                          ela +a++elvk+a+ +ep+W  s       e +n +e+  +f +  +     + +ea+r+sg+v+ ++++ lve+l+d + +W+ ++  
                          57889********************66666666666677777766666***************997245679*********.99999999 PP

                START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgi 152
                             ka+++e ++sg      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    ++  +R+++lpSg+
                          999************************************************************85423333335568999********** PP

                START 153 liepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          ++++++ng +kvtwveh++++++++h+l+r+l++sgla+ga++w+a lqrqce+
                          ****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.285101161IPR001356Homeobox domain
SMARTSM003894.8E-21102165IPR001356Homeobox domain
CDDcd000861.31E-19103161No hitNo description
PfamPF000461.3E-19104159IPR001356Homeobox domain
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PROSITE profilePS5084846.46312556IPR002913START domain
SuperFamilySSF559618.79E-30315553No hitNo description
CDDcd088754.81E-115316552No hitNo description
SMARTSM002341.7E-45321553IPR002913START domain
PfamPF018525.5E-51322553IPR002913START domain
SuperFamilySSF559615.44E-10573681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968002.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like isoform X2
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLK3XEN00.0K3XEN0_SETIT; Uncharacterized protein
STRINGSi000344m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1